PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009601554.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 337aa    MW: 38093.7 Da    PI: 6.6732
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009601554.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM182.31.2e-5651321129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL++kv++ ++++ ++i++vd++k+ePwdLp+k++ +ekewyfFs +d+ky+tg r+nrat++gyWk+tgkdke+++ 
  XP_009601554.1   5 LPPGFRFHPTDEELITYYLTNKVSDFNFTA-KAIADVDLNKCEPWDLPAKASMGEKEWYFFSLKDRKYPTGLRTNRATEAGYWKTTGKDKEIFRG 98 
                     79*************************999.88***************999999****************************************9 PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                     ++ lvg+kktLvfy+grapkgekt+Wvmheyrle
  XP_009601554.1  99 GSVLVGMKKTLVFYRGRAPKGEKTNWVMHEYRLE 132
                     9999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.15E-643152IPR003441NAC domain
PROSITE profilePS5100559.8915152IPR003441NAC domain
PfamPF023657.9E-296131IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MEENLPPGFR FHPTDEELIT YYLTNKVSDF NFTAKAIADV DLNKCEPWDL PAKASMGEKE  60
WYFFSLKDRK YPTGLRTNRA TEAGYWKTTG KDKEIFRGGS VLVGMKKTLV FYRGRAPKGE  120
KTNWVMHEYR LETKFGFKPS KEEWVVCRVF HKSSTAKKPQ PTSSSQQSEE SPNCDTYTFA  180
NELGDIEPPN NFYGLATPSN GHICNNISLQ NYSNENMMNM NLNMNLAAAA TREAAISNTL  240
PLLPAAWSSS LLCSNLPSVD SLLLRALQFR GYNNQPREAT TSTTDYPFIQ TQNISHIGID  300
YNNPNLAVEV PSSSMVSDPV QQQQPQEQSY KLGSNIW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-56415816171NO APICAL MERISTEM PROTEIN
1ut4_B1e-56415816171NO APICAL MERISTEM PROTEIN
1ut7_A1e-56415816171NO APICAL MERISTEM PROTEIN
1ut7_B1e-56415816171NO APICAL MERISTEM PROTEIN
3swm_A1e-56415819174NAC domain-containing protein 19
3swm_B1e-56415819174NAC domain-containing protein 19
3swm_C1e-56415819174NAC domain-containing protein 19
3swm_D1e-56415819174NAC domain-containing protein 19
3swp_A1e-56415819174NAC domain-containing protein 19
3swp_B1e-56415819174NAC domain-containing protein 19
3swp_C1e-56415819174NAC domain-containing protein 19
3swp_D1e-56415819174NAC domain-containing protein 19
4dul_A1e-56415816171NAC domain-containing protein 19
4dul_B1e-56415816171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009601554.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3-like
RefseqXP_016504286.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3-like
TrEMBLM1A3A81e-139M1A3A8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000137531e-139(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.14e-99NAC domain containing protein 58